Transcript | Ll_transcript_137842 |
---|---|
CDS coordinates | 814-1251 (+) |
Peptide sequence | MSEWNNTRLKRILVDYMLRMSYYETAVKFAECSNIQDLVDIDVFQEAKTVMDALQNKDVSPALAWCAENKSRLKKTKSKLEFQLRLQEFIELVRAENNLRAITYARKHLAPWGATHMKELQRVIATLAFKRDTECATYKVRLCHV* |
ORF Type | complete |
Blastp | Macrophage erythroblast attacher from Rattus with 47.1% of identity |
---|---|
Blastx | Macrophage erythroblast attacher from Rattus with 42.61% of identity |
Eggnog | Macrophage erythroblast attacher(ENOG410XPGU) |
Kegg | Link to kegg annotations (298982) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428745.1) |
Pfam | CTLH/CRA C-terminal to LisH motif domain (PF10607.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer