Protein coding transcript 195767

• Transcript: Ll_transcript_137482
• CDS coordinates: 2-304 (+)
• Peptide sequence: SKLTRNIFCDLSSVKFEDLASWLMIAFVLSREVPVTFEKVSKLLAVMYIVSASSEQFSLSSFSKVLGENCWASYFHQASIGTHLTYRLLSNLSARYKNKVL
• ORF Type: internal

Annotations of Ll_transcript_137482

• Blastp: Separase from Arabidopsis with 51.02% of identity
• Blastx: Separase from Arabidopsis with 51.02% of identity
• Eggnog: extra spindle pole bodies homolog 1 (S. cerevisiae)(COG5155)
• Kegg: Link to kegg annotations (AT4G22970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425826.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;