Transcript | Ll_transcript_137473 |
---|---|
CDS coordinates | 2639-3184 (+) |
Peptide sequence | MELTLAKSQGYLKGQPQQNPRLLAVIGVYTGFGSRLKRNVFRGSWMPTGDALKKLEERGVVIRFVIGRSPNRGDSLDRNIDQENRSTKDFMILEGHEETEGELPKKAKIFFSTAVQNWDADFYVKVDDEINIDLEGLIELLQRRRGQDGAYIGCMKSGQVISEEGKQWYEPEWRKFGDEKTY |
ORF Type | 3prime_partial |
Blastp | Hydroxyproline O-galactosyltransferase HPGT2 from Arabidopsis with 75.14% of identity |
---|---|
Blastx | Hydroxyproline O-galactosyltransferase HPGT2 from Arabidopsis with 76.53% of identity |
Eggnog | Beta-1,3-galactosyltransferase(ENOG410XV5H) |
Kegg | Link to kegg annotations (AT4G32120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458880.1) |
Pfam | Galactosyltransferase (PF01762.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer