Protein coding transcript 195769

• Transcript: Ll_transcript_137477
• CDS coordinates: 217-738 (+)
• Peptide sequence: MEKERKASHAGSWYTNNPKQLSEELDGWLSSCDLTKSSDVRGVIAPHAGYSYSGRAAAYAFGNIDPSNITRVFLLGPSHHHYTPKCALSTATVYKTPIGDLPIDLEVNELLKATGKFEQMNIRVDEAEHSMEMHLPYLAKVFEGKPVKIVPILVGALSAENEAMYGQILSSYVD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_137477

• Blastp: Protein MEMO1 from Silurana with 53.22% of identity
• Blastx: Protein MEMO1 from Silurana with 53.22% of identity
• Eggnog: UPF0103 protein(COG1355)
• Kegg: Link to kegg annotations (448307)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437762.1)
• Pfam: Memo-like protein (PF01875.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;