Protein coding transcript 1958

• Transcript: Ll_transcript_352559
• CDS coordinates: 213-1037 (+)
• Peptide sequence: MLYIIGLGLGDEKDITIRGLEAIKSCTNVYMEAYTSLLSFGLSSNGLSNLEKLYGKSIILADREMVEEKSDDILSEAHNSNVAFLVVGDPFGATTHTDLVVRAKKMGIDVKIVHNASVMNAIGICGLQLYRYGETVSIPFFTDTWRPDSFYEKIQTNRNMGLHTLCLLDIRVKEPTLESLARGRKIYEPPRYMTINTAIEQLLEIEQAHQESAYGEDTECVGFARLGSEDQVIVAGTMKELQTIDFGAPLHCLVITGKTHPLEEEMLDFYRRGT*
• ORF Type: complete

Annotations of Ll_transcript_352559

• Blastp: Probable diphthine methyl ester synthase from Arabidopsis with 79.41% of identity
• Blastx: Probable diphthine methyl ester synthase from Arabidopsis with 79.41% of identity
• Eggnog: S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF- 2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis (By similarity)(COG1798)
• Kegg: Link to kegg annotations (AT4G31790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431416.1)
• Pfam: Tetrapyrrole (Corrin/Porphyrin) Methylases (PF00590.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;