Protein coding transcript 195886

• Transcript: Ll_transcript_138041
• CDS coordinates: 1-357 (+)
• Peptide sequence: IKMSRRLRYCYNEVAPFCALIIVQFTEVGVNILFKEATNKGLSYYVFIFYSFAISTLILLLPLPFIALRFSAQVCGYKGIDYSSPSVASAVSNLLPAFIFILAVFFRYSFLNLNNPFN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_138041

• Blastp: WAT1-related protein At5g40240 from Arabidopsis with 45.38% of identity
• Blastx: WAT1-related protein At5g40240 from Arabidopsis with 43.8% of identity
• Eggnog: EamA-like transporter family(ENOG4111BCK)
• Kegg: Link to kegg annotations (AT5G40240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433718.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;