Protein coding transcript 195894

• Transcript: Ll_transcript_138331
• CDS coordinates: 1-771 (+)
• Peptide sequence: EEEGDNDDGHIEDDDDDDEEEGVEYEVHMVDKKVVQQDDHTSSNKHPAAAAAAAANRDPLEVAKQIELHFQRASDSGSQVAKILEVGKLPYHPKHTGPYQASSKILHAVAPSLSLVSSQPSTSKSAESTELAATATLDFDFDLTMRSRNLSSTLQKLYLWEKKLYNEVKAEEKMRVLHDRKCRKLKRMDERGADFHKVESTRALIRSLSTKIRMAIQVVDRISMTINKIRDEELWPQLKELIQGQFVPFCKNHLHA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_138331

• Blastp: Nitrate regulatory gene2 protein from Arabidopsis with 32.98% of identity
• Blastx: Nitrate regulatory gene2 protein from Arabidopsis with 32.98% of identity
• Eggnog: Protein of unknown function (DUF632)(ENOG410YACB)
• Kegg: Link to kegg annotations (AT3G60320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435788.1)
• Pfam: Protein of unknown function (DUF632) (PF04782.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;