| Transcript | Ll_transcript_417435 |
|---|---|
| CDS coordinates | 1063-1557 (+) |
| Peptide sequence | MMADKMQAGLGILSIIFVHTSFLFKIYIIRIYFHGSQVESKPHNMIYNHPTLGLESPSDIKVMEVEISDSVLMEDNSNVEKAEAYMKELEDICNMLKKKREEAKELLVRAIVNDNNLLMLNHPIYEEKISSHSSFLSFLLCYLFIDNKAGYFLNISEHLEGSKIC |
| ORF Type | 3prime_partial |
| Blastp | Uncharacterized protein At4g18490 from Arabidopsis with 71.19% of identity |
|---|---|
| Blastx | Uncharacterized protein At4g18490 from Arabidopsis with 70.69% of identity |
| Eggnog | NA(ENOG410YV1B) |
| Kegg | Link to kegg annotations (AT4G18490) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424568.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer