Protein coding transcript 195988

• Transcript: Ll_transcript_139186
• CDS coordinates: 278-580 (+)
• Peptide sequence: MYLVLALLRVMVYLQLKLMVLALLNESDLVLSDDMIEAIVDKTFSDADTKGQGRIDQDQWKAFVSKHPSLIKNMTLPYLKDITLAFPSFVLRTEVEDSQV*
• ORF Type: complete

Annotations of Ll_transcript_139186

• Blastp: Calcineurin B-like protein 7 from Oryza sativa with 61.46% of identity
• Blastx: Calcineurin B-like protein 7 from Oryza sativa with 61.46% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (107276277)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437365.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;