Transcript | Ll_transcript_139186 |
---|---|
CDS coordinates | 278-580 (+) |
Peptide sequence | MYLVLALLRVMVYLQLKLMVLALLNESDLVLSDDMIEAIVDKTFSDADTKGQGRIDQDQWKAFVSKHPSLIKNMTLPYLKDITLAFPSFVLRTEVEDSQV* |
ORF Type | complete |
Blastp | Calcineurin B-like protein 7 from Oryza sativa with 61.46% of identity |
---|---|
Blastx | Calcineurin B-like protein 7 from Oryza sativa with 61.46% of identity |
Eggnog | Calcium-binding protein(COG5126) |
Kegg | Link to kegg annotations (107276277) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437365.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer