Protein coding transcript 196035

• Transcript: Ll_transcript_139356
• CDS coordinates: 500-1048 (+)
• Peptide sequence: MMKRIHYSSFIQAIRRTPRVIQIHLNFRFLCTQSPQLFPNHNNNLDTAENPECLSSRIENLPKGESVGSAFRTWMGDGFPVHAGHVFHAINRLRKLNFNKRALEVMEWVIRERPYRPRELDYAYLIEFTTKLHGISHGEKLISNIPCEFQNELLYNNLVIACLDKGVIRLSLEYMKKMRELGH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_139356

• Blastp: Pentatricopeptide repeat-containing protein At1g07590, mitochondrial from Arabidopsis with 61.34% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g07590, mitochondrial from Arabidopsis with 61.34% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G07590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455863.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;