Transcript | Ll_transcript_139351 |
---|---|
CDS coordinates | 432-1073 (+) |
Peptide sequence | MQVSEIQQLQLQLQVKHHKQHNPNNQDIPMCQKKIQIQDEKKVIVEGDDFLVPPLNFAMVDSGIFRSGFPKPDNFSFLQTLRLRSIIYLCPEPYPETNLEFLKSNGIKLYQFGIEGHKEPFVNIPEDTIREALKVLLDVRNHPLIIHCKRGKHRTGCLVGCYRKMQKWCLSSVFDEYQRFAAAKARVSDQRFVELFDISSMKHLPVIFSCLKR* |
ORF Type | complete |
Blastp | Probable tyrosine-protein phosphatase At1g05000 from Arabidopsis with 76.61% of identity |
---|---|
Blastx | Probable tyrosine-protein phosphatase At1g05000 from Arabidopsis with 76.61% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT1G05000) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455867.1) |
Pfam | Tyrosine phosphatase family (PF03162.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer