Transcript | Ll_transcript_417426 |
---|---|
CDS coordinates | 2779-3087 (+) |
Peptide sequence | MIYNHPTLGLESPSDIKVMEVEISDSVLMEDNSNVEKAEAYMKELEDICNMLKKKREEAKELLVRAIVNDNNLLMLNHPIYEEKIWKVQKFASELKSKGIRP* |
ORF Type | complete |
Blastp | Uncharacterized protein At4g18490 from Arabidopsis with 41.74% of identity |
---|---|
Blastx | Uncharacterized protein At4g18490 from Arabidopsis with 70.69% of identity |
Eggnog | NA(ENOG410YV1B) |
Kegg | Link to kegg annotations (AT4G18490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424568.1) |
Pfam | - |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer