| Transcript | Ll_transcript_417427 |
|---|---|
| CDS coordinates | 2801-3241 (+) |
| Peptide sequence | MMADKMQAGLGILSIIFVHTSFLFKIYIIRIYFHGSQVESKPHNMIYNHPTLGLESPSDIKVMEVEISDSVLMEDNSNVEKAEAYMKELEDICNMLKKKREEAKELLVRAIVNDNNLLMLNHPIYEEKIWKVQKFASELKSKGIRP* |
| ORF Type | complete |
| Blastp | Uncharacterized protein At4g18490 from Arabidopsis with 41.74% of identity |
|---|---|
| Blastx | Uncharacterized protein At4g18490 from Arabidopsis with 70.69% of identity |
| Eggnog | NA(ENOG410YV1B) |
| Kegg | Link to kegg annotations (AT4G18490) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424568.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer