Protein coding transcript 196108

• Transcript: Ll_transcript_138573
• CDS coordinates: 3-944 (+)
• Peptide sequence: SYNNLSGPIALTGALMNRGPTAFIGNSGLCGPPLKNPCALDNPGSAIAPSTFPFLPDYYPSLGNGSGKSEKNKGLSKGAIIGIVVGDVIGICIFGLLFSYIYSRVCGFNQDPNEDGIDKEGGVMRKKFLCFRKGESETLSDHVEQYDLVPLDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGCQRFKDFQTEIEAIGKLRHPNVVTLRAYYWSVDEKLLIYDYIPNGILTTAIHGEFSLKASLYFSNGNFFVFGDLTLVNCLFGFIRECWTCHIHAVILVRSNENHERNCKRIGLLA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_138573

• Blastp: Receptor protein kinase-like protein ZAR1 from Arabidopsis with 65.1% of identity
• Blastx: Receptor protein kinase-like protein ZAR1 from Arabidopsis with 65.16% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G01210)
• CantataDB: Link to cantataDB annotations (CNT0002653)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459434.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;