Transcript | Ll_transcript_64820 |
---|---|
CDS coordinates | 1-471 (-) |
Peptide sequence | MYVGPLDFFNAQTPDGLKSFGSALCMTSISLRNYVSSILVSIIMKISPPSITRQDGSPETSTTTPAIACWILVLEFGFGMKGAAVAICFSNWFKAIILALYIKFSPSCKSTWTGFSRKSLHNIAESSRDPANVEGRPKITPTWLRTTRGSLQTRVHY |
ORF Type | 3prime_partial |
Blastp | Protein NRT1/ PTR FAMILY 7.3 from Arabidopsis with 74.47% of identity |
---|---|
Blastx | Protein NRT1/ PTR FAMILY 7.3 from Arabidopsis with 58.26% of identity |
Eggnog | transporter(COG3104) |
Kegg | Link to kegg annotations (AT1G32450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421849.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer