Protein coding transcript 196156

• Transcript: Ll_transcript_64820
• CDS coordinates: 1-471 (-)
• Peptide sequence: MYVGPLDFFNAQTPDGLKSFGSALCMTSISLRNYVSSILVSIIMKISPPSITRQDGSPETSTTTPAIACWILVLEFGFGMKGAAVAICFSNWFKAIILALYIKFSPSCKSTWTGFSRKSLHNIAESSRDPANVEGRPKITPTWLRTTRGSLQTRVHY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_64820

• Blastp: Protein NRT1/ PTR FAMILY 7.3 from Arabidopsis with 74.47% of identity
• Blastx: Protein NRT1/ PTR FAMILY 7.3 from Arabidopsis with 58.26% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT1G32450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421849.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;