Transcript | Ll_transcript_64928 |
---|---|
CDS coordinates | 943-1935 (+) |
Peptide sequence | MVYPIVSLPQATVADLQTEIHRRTKKYPSRQRLTLPVQPGSKERPVVLNYNKSLKEYTDGKSETLTVVFKDLGPQVSYRTLFFCEYLGPLLLYPVFYYFPVIYEYLGYKGERVIHPVQTYAMYYWCFHYGKRILETFFVHRFSHATSPLSNVFRNCAYYWTFGSYIAYYVNHPLYTPVSDLQVKIGFGFGILCQVSNFFCHIILRNLRNPEGSGGYQIPRGFLFNIVTCANYTTEIYQWLGFNIATQTVAGYVFLAVATFIMSNWAIAKHRRLKKVCFHYLLFLLLIHFSAYSIKCKESCMVWLIYVQLFDGKEGRPRYPRRWIILPPFL* |
ORF Type | complete |
Blastp | Very-long-chain enoyl-CoA reductase from Arabidopsis with 72.17% of identity |
---|---|
Blastx | Very-long-chain enoyl-CoA reductase from Arabidopsis with 63.36% of identity |
Eggnog | Trans-2,3-enoyl-CoA(ENOG410XR2S) |
Kegg | Link to kegg annotations (AT3G55360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461882.1) |
Pfam | 3-oxo-5-alpha-steroid 4-dehydrogenase (PF02544.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer