Protein coding transcript 196171

• Transcript: Ll_transcript_64919
• CDS coordinates: 634-1065 (+)
• Peptide sequence: MKVTLVSRSGREIVKGGIQLGDSATVADLQTEIHRRTKKYPSRQRLTLPVQPGSKERPVVLNYNKSLKEYTDGKSETLTVVFKDLGPQVSYRTLFFCEYLGPLLLYPVFYYFPVIYEYLGYKGERVIHPVQTYAMYYWCFHYGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_64919

• Blastp: Very-long-chain enoyl-CoA reductase from Arabidopsis with 75.86% of identity
• Blastx: Very-long-chain enoyl-CoA reductase from Arabidopsis with 75.86% of identity
• Eggnog: Trans-2,3-enoyl-CoA(ENOG410XR2S)
• Kegg: Link to kegg annotations (AT3G55360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461885.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;