Protein coding transcript 196173

• Transcript: Ll_transcript_64922
• CDS coordinates: 793-1824 (+)
• Peptide sequence: MKVTLVSRSGREIVKGGIQLGDSATVADLQTEIHRRTKKYPSRQRLTLPVQPGSKERPVVLNYNKSLKEYTDGKSETLTVVFKDLGPQVSYRTLFFCEYLGPLLLYPVFYYFPVIYEYLGYKGERVIHPVQTYAMYYWCFHYGKRILETFFVHRFSHATSPLSNVFRNCAYYWTFGSYIAYYVNHPLYTPVSDLQVKIGFGFGILCQVSNFFCHIILRNLRNPEGSGGYQIPRGFLFNIVTCANYTTEIYQWLGFNIATQTVAGYVFLAVATFIMSNWAIAKHRRLKKVCFHYLLFLLLIHFSAYSIKCKESCMVWLIYVQLFDGKEGRPRYPRRWIILPPFL*
• ORF Type: complete

Annotations of Ll_transcript_64922

• Blastp: Very-long-chain enoyl-CoA reductase from Arabidopsis with 72.38% of identity
• Blastx: Very-long-chain enoyl-CoA reductase from Arabidopsis with 72.38% of identity
• Eggnog: Trans-2,3-enoyl-CoA(ENOG410XR2S)
• Kegg: Link to kegg annotations (AT3G55360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461882.1)
• Pfam: 3-oxo-5-alpha-steroid 4-dehydrogenase (PF02544.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;