| Transcript | Ll_transcript_64642 |
|---|---|
| CDS coordinates | 388-1074 (+) |
| Peptide sequence | MEFAGATATLSKKLSNGYGVSGRSAYDGVFAAPVKLRASSFSSRLEDYREVFGSFGASSIPVLEVPELKERKKNDDIRHSKLDYSKVFGGIGNLEAAVPFEELIREPKHKKRNSFSMGESPERSKAKGGNQSCREDPTKYSKENPTLLRSSNDTSRINMSYLMVNQGSDVAQIHAVPAYTCLIEEVNPVKVNRDNPVKVKRDNPVNVNRDNPVKVKRDNPVNVNRDNPV |
| ORF Type | 3prime_partial |
| Blastp | Auxilin-like protein 1 from Arabidopsis with 39.13% of identity |
|---|---|
| Blastx | Auxilin-like protein 1 from Arabidopsis with 40.4% of identity |
| Eggnog | UBA TS-N domain protein(ENOG410YGT5) |
| Kegg | Link to kegg annotations (AT1G75310) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458164.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer