Protein coding transcript 196235

• Transcript: Ll_transcript_64632
• CDS coordinates: 139-1047 (+)
• Peptide sequence: MMISSSPTTLLHSHNNTLSSTLTHNHHHSISFSSKTIGTHKNKVGRISASASRSFDVVIVGAGVIGLTIAQQLLKASDLSVAIVDKAIPCSGATGAGQGYLWMSHKTPGSATWDLTWRSHQLWKMLAESLQEQGLNPLVELGWKKTGSLLVGRSRAESDMLKGRVKQLNEAGLKAEYLSSSDLFKQEPDLLVDEDSAAAFLPDDCQLDAHLTVAHIEKANRNFASEGRYAEFYNEPVKCFIRSDSNGEVNTVQTFKNTLHSKKAIVVATGCWTGCLIQDLFRNWGMEIDVPVKPRKVCLYTA*
• ORF Type: complete

Annotations of Ll_transcript_64632

• Blastp: Monomeric sarcosine oxidase from Bacillus with 23.58% of identity
• Blastx: Monomeric sarcosine oxidase from Bacillus with 23.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461232.1)
• Pfam: Thi4 family (PF01946.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;