Protein coding transcript 196304

• Transcript: Ll_transcript_64766
• CDS coordinates: 2-460 (+)
• Peptide sequence: KLKEKKMATVPGQLVWEIVKRNNSFLVKQFGRGSQSIEFSKEPNNLYNLNSYKYSGLANKKTVSIQANGKDQGVLLATTKTKKQNKPSALVHKSVLKKDFRRLAKAVKNQVADNHYRPDLKKAALARLSVVHKSLKIAKSGPKKRNRQGARK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_64766

• Blastp: 60S ribosomal protein L28-2 from Arabidopsis with 74.13% of identity
• Blastx: 60S ribosomal protein L28-2 from Arabidopsis with 74.65% of identity
• Eggnog: protein complex subunit organization(ENOG4111T32)
• Kegg: Link to kegg annotations (AT4G29410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443475.1)
• Pfam: Ribosomal L28e protein family (PF01778.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;