Transcript | Ll_transcript_64766 |
---|---|
CDS coordinates | 2-460 (+) |
Peptide sequence | KLKEKKMATVPGQLVWEIVKRNNSFLVKQFGRGSQSIEFSKEPNNLYNLNSYKYSGLANKKTVSIQANGKDQGVLLATTKTKKQNKPSALVHKSVLKKDFRRLAKAVKNQVADNHYRPDLKKAALARLSVVHKSLKIAKSGPKKRNRQGARK* |
ORF Type | 5prime_partial |
Blastp | 60S ribosomal protein L28-2 from Arabidopsis with 74.13% of identity |
---|---|
Blastx | 60S ribosomal protein L28-2 from Arabidopsis with 74.65% of identity |
Eggnog | protein complex subunit organization(ENOG4111T32) |
Kegg | Link to kegg annotations (AT4G29410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443475.1) |
Pfam | Ribosomal L28e protein family (PF01778.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer