Protein coding transcript 196311

• Transcript: Ll_transcript_64776
• CDS coordinates: 174-506 (+)
• Peptide sequence: MAEKYNLKNPAVKRILQEVKEMQSNPSHDFMSLPLEENIFEWQFAIRGPRETEFEGGIYHGRIQLPAEYPFKPPSFMLLTPNGRFETQTKICLSISNHHPEHWQPSWSGK*
• ORF Type: complete

Annotations of Ll_transcript_64776

• Blastp: Ubiquitin-conjugating enzyme E2 32 from Arabidopsis with 89.81% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 32 from Arabidopsis with 79.07% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT3G17000)
• CantataDB: Link to cantataDB annotations (CNT0000465)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440167.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;