Protein coding transcript 196330

• Transcript: Ll_transcript_65158
• CDS coordinates: 908-1459 (+)
• Peptide sequence: MPEIQSSIPFLPRVTPKTLKMLYLTSISFISAIMLFGGLIAPTLELKLGIGGTSYEDFIRSLHLPMQLSQVDPIVASFSGGAVGVISVLMLIEASNVEKQEKNMCKYCRGTGYLACARCSASGVCLNVDPISVSNASVKQLQVPTTKRCPNCSGVGKVMCPTCLCTGMLMASEHDLRIDPFDM*
• ORF Type: complete

Annotations of Ll_transcript_65158

• Blastp: Protein ORANGE-LIKE, chloroplastic from Arabidopsis with 77.47% of identity
• Blastx: Protein ORANGE-LIKE, chloroplastic from Arabidopsis with 74.87% of identity
• Eggnog: NA(ENOG4110IJH)
• Kegg: Link to kegg annotations (AT5G06130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428636.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;