| Transcript | Ll_transcript_65164 |
|---|---|
| CDS coordinates | 135-476 (+) |
| Peptide sequence | MTTFTLHSLLHSFIIPPTPSTSSNTSIFSTSFKDTNNQFSFSKGTKFLKSRIIVYSSSSPKDAASGDNTQSNFCIIEGPETVQDFVQMQLQEIQDNIKSRRKKIFLLMEEVNL* |
| ORF Type | complete |
| Blastp | Protein ORANGE-LIKE, chloroplastic from Arabidopsis with 47.75% of identity |
|---|---|
| Blastx | Protein ORANGE-LIKE, chloroplastic from Arabidopsis with 76% of identity |
| Eggnog | NA(ENOG4110IJH) |
| Kegg | Link to kegg annotations (AT5G06130) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428637.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer