Protein coding transcript 196333

• Transcript: Ll_transcript_65171
• CDS coordinates: 135-917 (+)
• Peptide sequence: MTTFTLHSLLHSFIIPPTPSTSSNTSIFSTSFKDTNNQFSFSKGTKFLKSRIIVYSSSSPKDAASGDNTQSNFCIIEGPETVQDFVQMQLQEIQDNIKSRRKKIFLLMEEVRRLRVQQRLRSVQKLFNEVGQEESYEMPEIQSSIPFLPRVTPKTLKMLYLTSISFISAIMLFGGLIAPTLELKLGIGGTSYEDFIRSLHLPMQLSQVDPIVASFSGGAVGVISVLMLIEASNVEKQEKNMCKYCRGTGTFRSYSLRVYL*
• ORF Type: complete

Annotations of Ll_transcript_65171

• Blastp: Protein ORANGE-LIKE, chloroplastic from Arabidopsis with 63.45% of identity
• Blastx: Protein ORANGE-LIKE, chloroplastic from Arabidopsis with 72.64% of identity
• Eggnog: NA(ENOG4110IJH)
• Kegg: Link to kegg annotations (AT5G06130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428637.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;