Protein coding transcript 196399

• Transcript: Ll_transcript_65466
• CDS coordinates: 2-331 (+)
• Peptide sequence: DFGLANLALDANTHITTRVMGTFGYVAPEYASSGKLTEKSDVYSFGVVLLELITGRKSVDASQPIGDESLVEWVSIDVLSLLLLKLSFANMVFEKLLACIKELIQIEVN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_65466

• Blastp: Proline-rich receptor-like protein kinase PERK10 from Arabidopsis with 91.78% of identity
• Blastx: Proline-rich receptor-like protein kinase PERK10 from Arabidopsis with 90.54% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G26150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456151.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;