Protein coding transcript 196417

• Transcript: Ll_transcript_64226
• CDS coordinates: 1061-1468 (+)
• Peptide sequence: MINKTISFAKAVCCCCCHCFGLIRRRCQRLEPTVNNNNNLSQGLLLGDDSDVQACPKRSLDILNSRLENGMTCKQFAVKETHNLVLSKDKDGNKMINEYIRVCKIGSGAYGKVALYRSSVSGNDYAMKVRILWCS*
• ORF Type: complete

Annotations of Ll_transcript_64226

• Blastp: Serine/threonine-protein kinase GRIK1 from Arabidopsis with 40.14% of identity
• Blastx: Serine/threonine-protein kinase GRIK2 from Arabidopsis with 56.94% of identity
• Eggnog: Calcium calmodulin-dependent protein kinase kinase(ENOG410YHHF)
• Kegg: Link to kegg annotations (AT3G45240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004505984.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;