Protein coding transcript 19642

• Transcript: Ll_transcript_417804
• CDS coordinates: 25-543 (+)
• Peptide sequence: MNACVFSFSSMIFPRFHRYLRFSNPLNLISPSSSSIISLLSNQVSSPITTDTASDHKNAPWLIVGLGNPGKTFNATRHNVGFEMVDAIAEAEGISMSSVSFKALFGKGYIGDVPVILAKPQTFMNLSGQSVGAIVSYYKIPLKQVLVIFDDLDLPFAKLRLLPKGGHGGHNG*
• ORF Type: complete

Annotations of Ll_transcript_417804

• Blastp: Peptidyl-tRNA hydrolase, chloroplastic from Arabidopsis with 82.3% of identity
• Blastx: Peptidyl-tRNA hydrolase, chloroplastic from Arabidopsis with 80.95% of identity
• Eggnog: The natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis (By similarity)(COG0193)
• Kegg: Link to kegg annotations (AT1G18440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446278.1)
• Pfam: Peptidyl-tRNA hydrolase (PF01195.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;