Transcript | Ll_transcript_64231 |
---|---|
CDS coordinates | 651-1259 (+) |
Peptide sequence | MFNKTSSFAKAMGCCNCFGFIRRRRRQRPNPTINNNNKNLSQELLLDDDIDDDDHSYNDSATNASSGDDSELQARPKRSEDILNLRVENDMMCRQYPVKVTLKLFRTEDENGNKMLNEYVRECKIGSGSYGKVALYRSSVDGNHYAIKAFHKSHLLKLRVAPSETAMTDVLREVLIMKMLEHPNIVNLIEVIDDPESDNFYMV |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase GRIK2 from Arabidopsis with 56.46% of identity |
---|---|
Blastx | Serine/threonine-protein kinase GRIK2 from Arabidopsis with 55.02% of identity |
Eggnog | Calcium calmodulin-dependent protein kinase kinase(ENOG410YHHF) |
Kegg | Link to kegg annotations (AT5G60550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413380.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer