Protein coding transcript 196423

• Transcript: Ll_transcript_64232
• CDS coordinates: 522-863 (+)
• Peptide sequence: MLNKTCSFAKAMGCCNCFGFIRRPRPRGQRPKHTISSSNNNISQELLLDDDIDDDDRSYSDSATNTSGGDDGEQKARPKRSEDILNLRVENDMMCRRFPVKETHKVVRTEDEYG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_64232

• Blastp: Serine/threonine-protein kinase GRIK2 from Arabidopsis with 33.62% of identity
• Blastx: Serine/threonine-protein kinase GRIK2 from Arabidopsis with 30% of identity
• Eggnog: Calcium calmodulin-dependent protein kinase kinase(ENOG410YHHF)
• Kegg: Link to kegg annotations (AT5G60550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453977.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;