Transcript | Ll_transcript_64235 |
---|---|
CDS coordinates | 542-883 (+) |
Peptide sequence | MLNKTCSFAKAMGCCNCFGFIRRPRPRGQRPKHTISSSNNNISQELLLDDDIDDDDRSYSDSATNTSGGDDGEQKARPKRSEDILNLRVENDMMCRRFPVKETHKVVRTEDEYG |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase GRIK2 from Arabidopsis with 33.62% of identity |
---|---|
Blastx | Serine/threonine-protein kinase GRIK2 from Arabidopsis with 30% of identity |
Eggnog | Calcium calmodulin-dependent protein kinase kinase(ENOG410YHHF) |
Kegg | Link to kegg annotations (AT5G60550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453977.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer