Protein coding transcript 196432

• Transcript: Ll_transcript_65381
• CDS coordinates: 34-1119 (+)
• Peptide sequence: MRNRESAQLSRQRKKHYVEELEEKVKAMNLTIADLNSKISFVMAENANMRQQLGAAASGMYPHPPMAPMPYPWFPCAPYVVKPQGSQVPLVPIPRLRPQQHVAAPKSKKSEGKKSGVKTKKVASISFLGLFFFMMLFGGFFSLLGVKFGGLVNNLTGRSSYVSDRWVYGQSGGKVWPVNGGHRDESERDEDVGFSDGRFSISDKRNYERRRKLEESNERHDLHSDESVRPGGNASEPLVASLYVPRNDKLVKIDGNLIIHSIMASEKTMASQTESQVKKDKRETGLAIPNSALAIPEAGRNSGQHPHMYRVSLEQRKALGSGSTKTLKDHMKSSATDGKMQQWFREGLAGDYQSFLLTFAL*
• ORF Type: complete

Annotations of Ll_transcript_65381

• Blastp: bZIP transcription factor 17 from Arabidopsis with 53.15% of identity
• Blastx: bZIP transcription factor 17 from Arabidopsis with 53.26% of identity
• Eggnog: Transcription factor(ENOG410XUDS)
• Kegg: Link to kegg annotations (AT2G40950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458105.1)
• Pfam: bZIP transcription factor (PF00170.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;