Protein coding transcript 196465

• Transcript: Ll_transcript_63200
• CDS coordinates: 451-864 (+)
• Peptide sequence: MKPLPAPQGYSTSVPYLGSNVPSSMYLGVPPYGSSLFSGSSILPYDVPFSGRIAYHHDYGSHLPAGSPHRPLLLSGPAPYSSGLMMGNNGMYGLPPLVDRFGMGIPIGPGPLGLRPGFFPEENSPKRGTGLSCLAYV*
• ORF Type: complete

Annotations of Ll_transcript_63200

• Blastp: RanBP2-type zinc finger protein At1g67325 from Arabidopsis with 52.67% of identity
• Blastx: RanBP2-type zinc finger protein At1g67325 from Arabidopsis with 54.88% of identity
• Eggnog: Zinc finger, RAN-binding domain containing 2(ENOG4111QXA)
• Kegg: Link to kegg annotations (AT1G67325)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464619.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;