Protein coding transcript 196473

• Transcript: Ll_transcript_63199
• CDS coordinates: 49-723 (+)
• Peptide sequence: MEHAENCLVWFHQRSHRSFLFAHSKTVPLNSPFVFMSQVDNRNSSASKRARTDGSRREDDWTCPSCGNVNFSFRTTCNMRNCTQPRPADHNSKSSMKPLPAPQGYSTSVPYLGSNVPSSMYLGVPPYGSSLFSGSSILPYDVPFSGRIAYHHDYGSHLPAGSPHRPLLLSGPAPYSSGLMMGNSMLCIYLINKIDLFIKLGKDWGSGDKAAIKKAHSLYRIFPF*
• ORF Type: complete

Annotations of Ll_transcript_63199

• Blastp: RanBP2-type zinc finger protein At1g67325 from Arabidopsis with 70.71% of identity
• Blastx: RanBP2-type zinc finger protein At1g67325 from Arabidopsis with 70.71% of identity
• Eggnog: Zinc finger, RAN-binding domain containing 2(ENOG4111QXA)
• Kegg: Link to kegg annotations (AT1G67325)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460337.1)
• Pfam: Zn-finger in Ran binding protein and others (PF00641.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;