Transcript | Ll_transcript_63174 |
---|---|
CDS coordinates | 119-535 (+) |
Peptide sequence | MAKGVAVLGSSAGVTGTVYFNQEGNGPTTVTGTLSGLKPGFHGFHVHALGDTTNGCLSTGSHYNPNGKEHGAPEDDNRHAGDLGNINVGDDGTVSFSITDNQIPLTGPNSIIGRAVVVHADPDDLGKGTHKPILFTGA* |
ORF Type | complete |
Blastp | Superoxide dismutase [Cu-Zn] from Soja with 83.21% of identity |
---|---|
Blastx | Superoxide dismutase [Cu-Zn] from Soja with 83.21% of identity |
Eggnog | Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity)(COG2032) |
Kegg | Link to kegg annotations (100499991) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419259.1) |
Pfam | Copper/zinc superoxide dismutase (SODC) (PF00080.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer