Protein coding transcript 196479

• Transcript: Ll_transcript_63191
• CDS coordinates: 119-511 (+)
• Peptide sequence: MAKGVAVLGSSAGVTGTVYFNQEGNGPTTVTGTLSGLKPGFHGFHVHALGDTTNGCLSTGSHYNPNGKEHGAPEDDNRHAGDLGNINVGDDGTVSFSITDNQIPLTGPNSIIGRAVVVHADPDDLGKGIH*
• ORF Type: complete

Annotations of Ll_transcript_63191

• Blastp: Superoxide dismutase [Cu-Zn] from Soja with 86.15% of identity
• Blastx: Superoxide dismutase [Cu-Zn] from Soja with 86.15% of identity
• Eggnog: Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity)(COG2032)
• Kegg: Link to kegg annotations (100499991)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419259.1)
• Pfam: Copper/zinc superoxide dismutase (SODC) (PF00080.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;