Protein coding transcript 196541

• Transcript: Ll_transcript_63843
• CDS coordinates: 374-811 (+)
• Peptide sequence: MHMWGHGSQYRKGSDSLKGAQPTAMLRLPCFCCAPKCKHNIDHPRAKPLKDFRTLQTHYKRKHGVKPYTCRKCGKAFAVKGDWRTHEKNCGKIWYCLCGSDFKHKRSLKDHIKAFGFGHGVFGMDCLQKEDEAASEIEHDEDSSL*
• ORF Type: complete

Annotations of Ll_transcript_63843

• Blastp: Zinc finger protein WIP2 from Arabidopsis with 81.88% of identity
• Blastx: Zinc finger protein WIP2 from Arabidopsis with 81.43% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT3G57670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451539.1)
• Pfam: Zinc finger, C2H2 type (PF00096.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;