Protein coding transcript 196543

• Transcript: Ll_transcript_63854
• CDS coordinates: 125-748 (+)
• Peptide sequence: MTDPRSKLFDGWFNFMPLHPSHCSYDSHDQSSFFSSSSSSYPLSYSSNNRFGIHSEASSSSNIACPSSPPLREALPLINKLSITNPHQNIEPSNGTYIAVEEDKEVESFFTGTGYDDGDGTAVTVSLNIGLPKMNTSSDLGSRKVSSTSKEITEKEGVNMISGHPFDGLNKGHYWIPTPSQILIGPTQFSCHVCSKTFNRYNNLQVI*
• ORF Type: complete

Annotations of Ll_transcript_63854

• Blastp: Zinc finger protein WIP4 from Arabidopsis with 40.12% of identity
• Blastx: Zinc finger protein WIP4 from Arabidopsis with 39.22% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT3G20880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450451.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;