Protein coding transcript 196566

• Transcript: Ll_transcript_65535
• CDS coordinates: 3-332 (+)
• Peptide sequence: QYLQECHRQLMGEQLSGLGIKELQNLENQLEMSLKGVRVKKDEILTDEIKELHRKGNLVHQENVELHKKMDLVHKENAELQKKVFEAGVNEENVASDTSYTITDGYDLHA
• ORF Type: internal

Annotations of Ll_transcript_65535

• Blastp: MADS-box transcription factor 27 from Oryza sativa with 63.73% of identity
• Blastx: MADS-box transcription factor 27 from Oryza sativa with 63.73% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (4329771)
• CantataDB: Link to cantataDB annotations (CNT0002265)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425955.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;