Protein coding transcript 196583

• Transcript: Ll_transcript_64701
• CDS coordinates: 223-663 (+)
• Peptide sequence: MAQTFILFTIPNLFFLLLLHPVRIYLRTQGISLPVTYCSVISTLLHVPLNFLLVVHFHMGKTWVALAMVWTNFNLFICLSSLIYISGVYKDSWVSRSMDCLRAGNGLVGMRRRDLIKWHVNQQNEEKKYNIMEEEAKEKFTTLKLL*
• ORF Type: complete

Annotations of Ll_transcript_64701

• Blastp: Protein DETOXIFICATION 49 from Arabidopsis with 48.04% of identity
• Blastx: Protein DETOXIFICATION 48 from Arabidopsis with 58.95% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT4G23030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416038.1)
• Pfam: MatE (PF01554.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;