Protein coding transcript 196773

• Transcript: Ll_transcript_64404
• CDS coordinates: 316-840 (+)
• Peptide sequence: MISAGVLSLLEEMISNTSSYGCATALYLNLSCLEDAKPMIGSSQAVQFLIQILQTKTDIQCKLDSLHALYNLSTVPSNIPHLLSSGIINTLQSVLVGHSDSLWTEKCIAVLINLAISQVGREEIMLAPELISALASILDTGELQEQEQAVSCLLILCNRSEKCCEMVLQEGVIPA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_64404

• Blastp: U-box domain-containing protein 7 from Arabidopsis with 61.71% of identity
• Blastx: U-box domain-containing protein 7 from Arabidopsis with 62.22% of identity
• Eggnog: Ubox domain-containing protein(ENOG410XQ5K)
• Kegg: Link to kegg annotations (AT1G67530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438307.1)
• Pfam: Kinesin-associated protein (KAP) (PF05804.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;