Transcript | Ll_transcript_64260 |
---|---|
CDS coordinates | 974-1420 (+) |
Peptide sequence | MGWLLSPTNYMVELVPAKQSDTNGGMFEIMTPKARADIHMNLPALQKLDSMLIEALDSMVKPEFWYAEGGSRAEGRSTTSACSSKRWWLPSPQVPRTGLSDTERKRLLHHGRVVSQVFKAAKSINENVLLEMPVPAKIKDALEKVIFW* |
ORF Type | complete |
Blastp | Rop guanine nucleotide exchange factor 14 from Arabidopsis with 72.92% of identity |
---|---|
Blastx | Rop guanine nucleotide exchange factor 14 from Arabidopsis with 72.67% of identity |
Eggnog | Guanine nucleotide exchange factor(ENOG410YFCK) |
Kegg | Link to kegg annotations (AT1G31650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445182.1) |
Pfam | PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer