Protein coding transcript 196817

• Transcript: Ll_transcript_64271
• CDS coordinates: 232-594 (+)
• Peptide sequence: MEWLLSPTNYMVELVPAKQNGANGGIFEIMTAKARADIELNLPALQKLDSMLIETLDSMANTEFWYAEGGSEGEERNTSGRQNQRWWLPSPKVPRNGLSDAERKRLLHQGRVVHQVFKAAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_64271

• Blastp: Rop guanine nucleotide exchange factor 14 from Arabidopsis with 71.07% of identity
• Blastx: Rop guanine nucleotide exchange factor 14 from Arabidopsis with 69.59% of identity
• Eggnog: Guanine nucleotide exchange factor(ENOG410YFCK)
• Kegg: Link to kegg annotations (AT1G31650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446939.1)
• Pfam: PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;