Protein coding transcript 196857

• Transcript: Ll_transcript_65753
• CDS coordinates: 53-694 (+)
• Peptide sequence: MMALHKTYPFLHHSRFRCMLHQIPLSPSLTSLLSATTTSSSSLHGAVSSAITHVAVTALAIASGACLSTKLDFLWPKLDQQPGTIIQDGVDVTGYPIFNDAKVHKAIAFARKAHRGQMRKTGDPYLTHCIHTGRILAMLVPSSGKRAVDTVVAGILHDVVDDTCQSLQDIEEEFGDDVVNLVAGVSRLSYINQVCFFIFKEVAHYGLPYLVSC*
• ORF Type: complete

Annotations of Ll_transcript_65753

• Blastp: Probable GTP diphosphokinase RSH3, chloroplastic from Arabidopsis with 49% of identity
• Blastx: Probable GTP diphosphokinase RSH3, chloroplastic from Arabidopsis with 49% of identity
• Eggnog: In eubacteria ppGpp (guanosine 3'-diphosphate 5-' diphosphate) is a mediator of the stringent response that coordinates a variety of cellular activities in response to changes in nutritional abundance (By similarity)(COG0317)
• Kegg: Link to kegg annotations (AT1G54130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423473.1)
• Pfam: HD domain (PF13328.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;