Protein coding transcript 196860

• Transcript: Ll_transcript_65740
• CDS coordinates: 729-1553 (+)
• Peptide sequence: MLLGMVDDPRVVLIKLADRLHNMRTIHALPLQKAQAVAEETLIIWCSLASRLGLWALQAELEDLCFAVLQPQVFQKMRADLASMWSPTCRTENPRRFSVKGSLIPLDENSSTSSSNESLTLNEEVSSMKDLLEAVVPFDILLDRRKRANFLCGIGNNLETCMKPKVVQDAGLALASLVVCEEALERELIISASYVPGMEVTLSSRLKSMYSLYSKMKRKDISIDKVYDARALRVVVGDKNGTLHGAAVQGCYSLLDIVHRYIKVKFQFSFNHIA*
• ORF Type: complete

Annotations of Ll_transcript_65740

• Blastp: Probable guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase from Synechocystis with 49.37% of identity
• Blastx: Probable GTP diphosphokinase RSH3, chloroplastic from Arabidopsis with 47.59% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (slr1325)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423473.1)
• Pfam: HD domain (PF13328.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;