Protein coding transcript 19688

• Transcript: Ll_transcript_418860
• CDS coordinates: 1686-2132 (+)
• Peptide sequence: MQLSEAMDCLEHICTEGCTDVGPYDVELSKEKRKPCSKFDTCQPIQVLIRHFATCKKRVNGGCLRCKGMWQLFRLHSFICQHDSCKVPLCRQIQLKMQLENKKVDAKWKLLARKVASVKAMSSLSVPKRKRNEEIRDTIINSGIRNFK*
• ORF Type: complete

Annotations of Ll_transcript_418860

• Blastp: BTB/POZ and TAZ domain-containing protein 2 from Arabidopsis with 56.25% of identity
• Blastx: BTB/POZ and TAZ domain-containing protein 2 from Arabidopsis with 56.85% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (AT3G48360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414255.1)
• Pfam: TAZ zinc finger (PF02135.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;