Protein coding transcript 196927

• Transcript: Ll_transcript_65093
• CDS coordinates: 1411-1995 (+)
• Peptide sequence: MLIHKALMDINESPVYLLLNPSINHSQKDLPVSIFESELHVIDGIPQLIFVRSSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLHSRIKVLHHYLVAMQKGDVPCENSLLRQVSSLLRRLPAIESGKFQDDFLMEYNDTLLISYLAMLTNCSSATNDLVDKFNTAYDRHSRRGGRTAFM*
• ORF Type: complete

Annotations of Ll_transcript_65093

• Blastp: COP9 signalosome complex subunit 6a from Arabidopsis with 83.51% of identity
• Blastx: COP9 signalosome complex subunit 6a from Arabidopsis with 84.33% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310)
• Kegg: Link to kegg annotations (AT5G56280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419995.1)
• Pfam: Maintenance of mitochondrial structure and function (PF13012.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;