Protein coding transcript 19693

• Transcript: Ll_transcript_418881
• CDS coordinates: 81-1100 (+)
• Peptide sequence: MDAPKTNPFRVTRVLPEPDLYLHTSRGKPIPVHAIILASGSPVLENIIMSNRTVKIHGVPYDAVIAFLSFIYTSRCTEEEMEKYGMHLLALSHVYLVPQLKRSCIKGLSQRVNTENVVDVLQLAKMCDAPDLYVKCFKLLTDNYKEVENTEGWRFLQHHDPRLELDILRLMDEHESRKKKCRKQREEEGLYMQLSEAMDCLEHICTEGCTDVGPYDVELSKEKRKPCSKFDTCQPIQVLIRHFATCKKRVNGGCLRCKGMWQLFRLHSFICQHDSCKVPLCRQIQLKMQLENKKVDAKWKLLARKVASVKAMSSLSVPKRKRNEEIRDTIINSGIRNFK*
• ORF Type: complete

Annotations of Ll_transcript_418881

• Blastp: BTB/POZ and TAZ domain-containing protein 2 from Arabidopsis with 55.15% of identity
• Blastx: BTB/POZ and TAZ domain-containing protein 2 from Arabidopsis with 55.15% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (AT3G48360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414255.1)
• Pfam: BTB/POZ domain (PF00651.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;