Protein coding transcript 19698

• Transcript: Ll_transcript_418882
• CDS coordinates: 407-922 (+)
• Peptide sequence: MALEALNSPTPFSSSYKEEDKEIDLHMSEAWAKRKRSKRPRLDTPPTEEEYLALCLIMLAQSGNNNNNNTTDSPGKEKIESASSKSQPPQQQKEEQESLPAIKVMSHRCSVCDKAFPSYQALGGHKASHRKSLSENGTTVAATTTTTNSTSTAIATKKLHECSICHHNHHQ*
• ORF Type: complete

Annotations of Ll_transcript_418882

• Blastp: Zinc finger protein AZF2 from Arabidopsis with 38.74% of identity
• Blastx: Zinc finger protein ZAT10 from Arabidopsis with 38.51% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT3G19580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429041.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;