Protein coding transcript 1970

• Transcript: Ll_transcript_355468
• CDS coordinates: 2-487 (+)
• Peptide sequence: SSLQHQLGSKIPNGILNFFFKFTYGRKGAKKVKAQGMGVHKPEEISEFGRRDLKVLSEQLGDKPFFFGDEPTSLDVVAFANLAQVYFIDKEVNYPLRDFMQENCANLVGLVNRMKERCFPDWEDMCKNLDMNSHLPKPPPEEKEEKKEGKEEKGEKEGDKEN
• ORF Type: internal

Annotations of Ll_transcript_355468

• Blastp: Failed axon connections from Sophophora with 60.84% of identity
• Blastx: Failed axon connections from Sophophora with 62.77% of identity
• Eggnog: failed axon connections homolog (Drosophila)(ENOG4111HSJ)
• Kegg: Link to kegg annotations (Dmel_CG4609)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004500374.1)
• Pfam: Glutathione S-transferase, C-terminal domain (PF17171.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;